Mouse Anti-Cattle XIAP Antibody (MO-AB-23016R)


Cat: MO-AB-23016R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO23016R
SpecificityThis antibody binds to Cattle XIAP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to a family of apoptotic suppressor proteins. Members of this family share a conserved motif termed, baculovirus IAP repeat, which is necessary for their anti-apoptotic function. This protein functions through binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2 and inhibits apoptosis induced by menadione, a potent inducer of free radicals, and interleukin 1-beta converting enzyme. This protein also inhibits at least two members of the caspase family of cell-death proteases, caspase-3 and caspase-7. Mutations in this gene are the cause of X-linked lymphoproliferative syndrome. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 2 and 11.[provided by RefSeq, Feb 2011]
Product OverviewThis product is a mouse antibody against XIAP. It can be used for XIAP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesX-linked inhibitor of apoptosis protein, Fragment; XIAP
UniProt IDQ8WMY4
Protein RefseqThe length of the protein is 109 amino acids long.
The sequence is show below: NWEPCDRAWSEHRRHFPNCFFVLGRNINMQSESSVVSSDRNFPNSTNAPINPAMADYEARIITFGTWMYSVNKEQLARAGFYALGEGDKVQCFHCGGGLNDWKPVKTLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry