AibGenesis™ Mouse Anti-ZC2HC1B Antibody (MO-AB-23122R)


Cat: MO-AB-23122R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23122R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO23122R 100 µg
MO-AB-30084H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30084C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO23122R
SpecificityThis antibody binds to Cattle ZC2HC1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against ZC2HC1B. It can be used for ZC2HC1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZinc finger C2HC domain-containing protein 1B; ZC2HC1B; FAM164B
UniProt IDQ32KN7
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: MAGAQPFLADGNQELFPCEVCGRRFAADVLERHGPICRKLFNKKRKPFNSLKQRLRGTDIPTVGKAPQSKPQPVRKSNWRQHHEDFINAIQSAKQCTLAIKEGRPLPPPPPPTVNPDYIQCPYCKRRFNETAASRHINFCKDQESRRVFDPAQTAARLASRAQGRAQMSPKKELTVTSAVGALLQNRALEASAAPTRPAVDPASGAKLRQGFAKSSKKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry