AibGenesis™ Mouse Anti-CBF6 Antibody (MO-AB-00078W)


Cat: MO-AB-00078W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00078W Monoclonal Barrel medic (Medicago truncatula), Cottonwood (Populus deltoids) WB, ELISA MO00078W 100 µg
MO-AB-27296W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27296W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), Cottonwood (Populus deltoids)
CloneMO00078W
SpecificityThis antibody binds to Barrel medic CBF6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Barrel medic CBF6 Antibody is a mouse antibody against CBF6. It can be used for CBF6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-repeat binding factor 6; CBF6
UniProt IDS5MFR5
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MITTYNSSYSQSISSKDVSPLDPSSPDSEVRLAASNPKKRAGRKIFKETRHPVYRGVRKRNLNKWVCEMREPNTKNRIWLGTFPTAEMAARAHDVAAIALRGRYACLNFADSVWRLPIPATSAIKDIQKAATKAAEAFRPDNTLMTSDIDTVVAVVATQELNMFRVQVEEEEVLNMPELWRNMALMSPTHSFGYHDQYEDIHIQDFQDDEVSLWNF.
For Research Use Only | Not For Clinical Use.
Online Inquiry