AibGenesis™ Mouse Anti-CBLB Antibody (CBMOAB-38227FYA)


Cat: CBMOAB-38227FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38227FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO38227FYA 100 µg
CBMOAB-69165FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69165FYA 100 µg
MO-AB-12895W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12895W 100 µg
MO-AB-24352R Monoclonal Pig (Sus scrofa) WB, ELISA MO24352R 100 µg
MO-AB-52307W Monoclonal Marmoset WB, ELISA MO52307W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO38227FYA
SpecificityThis antibody binds to Rhesus CBLB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an E3 ubiquitin-protein ligase which promotes proteosome-mediated protein degradation by transferring ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate. The encoded protein is involved in the regulation of immune response by limiting T-cell receptor, B-cell receptor, and high affinity immunoglobulin epsilon receptor activation. Studies in mouse suggest that this gene is involved in antifungal host defense and that its inhibition leads to increased fungal killing. Manipulation of this gene may be beneficial in implementing immunotherapies for a variety of conditions, including cancer, autoimmune diseases, allergies, and infections. (From NCBI)
Product OverviewMouse Anti-Rhesus CBLB Antibody is a mouse antibody against CBLB. It can be used for CBLB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesE3 ubiquitin-protein ligase CBL-B; CBLB
UniProt IDH9FII8
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: KTWKLMDKVVRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRMFF.
For Research Use Only | Not For Clinical Use.
Online Inquiry