Mouse Anti-CBLN3 Antibody (CBMOAB-38232FYA)
Cat: CBMOAB-38232FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-38232FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO38232FYA | 100 µg | ||
MO-AB-09573R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09573R | 100 µg | ||
MO-AB-18708W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18708W | 100 µg | ||
MO-AB-24357R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24357R | 100 µg | ||
MO-AB-24528H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24528C | 100 µg | ||
MO-AB-52310W | Monoclonal | Marmoset | WB, ELISA | MO52310W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) |
Clone | MO38232FYA |
Specificity | This antibody binds to Rhesus CBLN3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Rhesus CBLN3 Antibody is a mouse antibody against CBLN3. It can be used for CBLN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cerebellin-3; CBLN3 |
UniProt ID | H9FBV3 |
Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: VKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry