Mouse Anti-CBLN3 Antibody (CBMOAB-38232FYA)


Cat: CBMOAB-38232FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38232FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO38232FYA 100 µg
MO-AB-09573R Monoclonal Cattle (Bos taurus) WB, ELISA MO09573R 100 µg
MO-AB-18708W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18708W 100 µg
MO-AB-24357R Monoclonal Pig (Sus scrofa) WB, ELISA MO24357R 100 µg
MO-AB-24528H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24528C 100 µg
MO-AB-52310W Monoclonal Marmoset WB, ELISA MO52310W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO38232FYA
SpecificityThis antibody binds to Rhesus CBLN3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CBLN3 Antibody is a mouse antibody against CBLN3. It can be used for CBLN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCerebellin-3; CBLN3
UniProt IDH9FBV3
Protein RefseqThe length of the protein is 75 amino acids long.
The sequence is show below: VKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry