Mouse Anti-CBR4 Antibody (CBMOAB-38237FYA)


Cat: CBMOAB-38237FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38237FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38237FYA 100 µg
CBMOAB-69208FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69208FYA 100 µg
MO-AB-09578R Monoclonal Cattle (Bos taurus) WB, ELISA MO09578R 100 µg
MO-AB-14957W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14957W 100 µg
MO-AB-24531H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24531C 100 µg
MO-AB-52320W Monoclonal Marmoset WB, ELISA MO52320W 100 µg
MO-DKB-01125W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38237FYA
SpecificityThis antibody binds to Rhesus CBR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCBR4 (Carbonyl Reductase 4) is a Protein Coding gene. Diseases associated with CBR4 include Horner's Syndrome. Among its related pathways are Metabolism and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and NADPH binding. An important paralog of this gene is HSD17B8.
Product OverviewMouse Anti-Rhesus CBR4 Antibody is a mouse antibody against CBR4. It can be used for CBR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCBR4
UniProt IDF7ASE5
Protein RefseqThe length of the protein is 237 amino acids long.
The sequence is show below: MDKVCAIFGGSRGIGRAVAQLMARKGYRLAIIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEEMEKHLGRVNFLVNAAGINRDSLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRAMIQQQGGSIVNVGDIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKKIPLGRFGETIEVAHAVVFLLESPYVTGHVLVVDGGLQLIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry