AibGenesis™ Mouse Anti-CCDC117 Antibody (CBMOAB-38298FYA)


Cat: CBMOAB-38298FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38298FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO38298FYA 100 µg
MO-AB-09603R Monoclonal Cattle (Bos taurus) WB, ELISA MO09603R 100 µg
MO-AB-10744W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10744W 100 µg
MO-AB-52368W Monoclonal Marmoset WB, ELISA MO52368W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO38298FYA
SpecificityThis antibody binds to Rhesus CCDC117.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCDC117 (Coiled-Coil Domain Containing 117) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus CCDC117 Antibody is a mouse antibody against CCDC117. It can be used for CCDC117 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCDC117
UniProt IDF7EL28
Protein RefseqThe length of the protein is 279 amino acids long.
The sequence is show below: MATLGRPFGGLPLSGSSDFLQPPPQPAFPGRAFPPGADGADLAPRSGPRAVPSSPAGSAARGRVSVHCKKKHKREEEDDDCPVRKKRITEAELCAGPNDWILCAHQDVEGHGVNPCISGLSVPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHAAAGTAFPQRTELFLEPRQPGMSLYNSLETATSTEEEMEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry