AibGenesis™ Mouse Anti-ccdc126 Antibody (CBMOAB-69304FYA)


Cat: CBMOAB-69304FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69304FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO69304FYA 100 µg
MO-AB-09608R Monoclonal Cattle (Bos taurus) WB, ELISA MO09608R 100 µg
MO-AB-17114W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17114W 100 µg
MO-AB-24546H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24546C 100 µg
MO-AB-52373W Monoclonal Marmoset WB, ELISA MO52373W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO69304FYA
SpecificityThis antibody binds to Zebrafish ccdc126.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ccdc126 Antibody is a mouse antibody against ccdc126. It can be used for ccdc126 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain containing 126; ccdc126; si:ch211-155k24.
UniProt IDQ0P3Y5
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MLGCLLRRSMSHRLSVFLVLFGLVWCLLLLHYTVTQPRRQSSAELRQQILELSHRYVKVLSEENQNPSGPHGTSMAGYADLKRTIAVLLDDILNRLVKLEGKVEAAVNASTHNISHPAGGTGILLAAVSRPTKQNLPAHRPERRSSNPLHFLPQSPGRPQKPHSLN.
For Research Use Only | Not For Clinical Use.
Online Inquiry