Mouse Anti-CCDC182 Antibody (MO-AB-03474W)


Cat: MO-AB-03474W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03474W Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO03474W 100 µg
MO-AB-24554H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24554C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO03474W
SpecificityThis antibody binds to Rhesus CCDC182.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC182 Antibody is a mouse antibody against CCDC182. It can be used for CCDC182 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-Coil Domain Containing 182
UniProt IDG7NHQ8
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MESLYQAGSILMTVNTLQGKKMVESGLQSGDFSLSQSWPSCLPPPADLEILQQKVAGVQRELEDFKKETLKSIHYLEDSFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDRGRDALRTTKKSQAD.
For Research Use Only | Not For Clinical Use.
Online Inquiry