Mouse Anti-CCDC79 Antibody (CBMOAB-38477FYA)


Cat: CBMOAB-38477FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38477FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO38477FYA 100 µg
CBMOAB-69428FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69428FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO38477FYA
SpecificityThis antibody binds to Rhesus CCDC79.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC79 Antibody is a mouse antibody against CCDC79. It can be used for CCDC79 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 79; CCDC79
UniProt IDH9FFS4
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: LCTSELFEDLTWFLSNDSNINLKRMSVYVILVLVSNNRTGQTLVRETGCITVLSRLFRTVISKYELDLSDKNVFQSYQLWSSVCSTLCVCVNNPQNDENQMFCCSLFPHANEWLKNFMKPEIIRPICSFIGLTLANNTYVQKYFVSVGGLDVLSQVLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry