AibGenesis™ Mouse Anti-CCDC85C Antibody (CBMOAB-38491FYA)


Cat: CBMOAB-38491FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38491FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO38491FYA 100 µg
MO-AB-12450W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12450W 100 µg
MO-AB-52431W Monoclonal Marmoset WB, ELISA MO52431W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO38491FYA
SpecificityThis antibody binds to Rhesus CCDC85C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCDC85C Antibody is a mouse antibody against CCDC85C. It can be used for CCDC85C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 85C; CCDC85C
UniProt IDH9FHF2
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: HVPPPLLPPGPHKAPEGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRLLEGDKLLAQQAGSGECRTLRKGFSPYHSESQLASLPPSYQDSLQNGLACPAPELPSPPSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry