AibGenesis™ Mouse Anti-CCDC86 Antibody (CBMOAB-38493FYA)


Cat: CBMOAB-38493FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38493FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO38493FYA 100 µg
MO-AB-09669R Monoclonal Cattle (Bos taurus) WB, ELISA MO09669R 100 µg
MO-AB-15447W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15447W 100 µg
MO-AB-52432W Monoclonal Marmoset WB, ELISA MO52432W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO38493FYA
SpecificityThis antibody binds to Rhesus CCDC86.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCDC86 (Coiled-Coil Domain Containing 86) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus CCDC86 Antibody is a mouse antibody against CCDC86. It can be used for CCDC86 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCoiled-coil domain-containing protein 86; CCDC86
UniProt IDH9FZP0
Protein RefseqThe length of the protein is 360 amino acids long.
The sequence is show below: MDTPLRRSRRLGGLRPESPESLTSVSRVRRALVELQSNPEETREPGSPPSVQQAGLGSPERPPETSPGSPRLQQGAGLESPQVQPEPGPGSPQRQQDLHLESPQRQPESRPESPRCQPKSSEEASKCSQDQGVLASELAQSKEELTPGAPQHQLPPGPGSPEPYPGQQAPGPEPSQPLLELTLKAPGSPRGQHEPSKPPPAGETVTGGLGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRKAENLKRRLENERKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQKQPPQRPAAKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry