Mouse Anti-CCL27 Antibody (CBMOAB-38538FYA)


Cat: CBMOAB-38538FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38538FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Rat (Rattus norvegicus) WB, ELISA MO38538FYA 100 µg
MO-AB-24584H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24584C 100 µg
MO-AB-29411W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29411W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Rat (Rattus norvegicus)
CloneMO38538FYA
SpecificityThis antibody binds to Rhesus CCL27.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL27 (C-C Motif Chemokine Ligand 27) is a Protein Coding gene. Diseases associated with CCL27 include Dermatitis and Dermatitis, Atopic. Among its related pathways are PEDF Induced Signaling and Akt Signaling. Gene Ontology (GO) annotations related to this gene include chemokine activity. An important paralog of this gene is CCL28.
Product OverviewMouse Anti-Rhesus CCL27 Antibody is a mouse antibody against CCL27. It can be used for CCL27 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C motif chemokine 27; CCL27
UniProt IDH9F6B3
Protein RefseqThe length of the protein is 92 amino acids long.
The sequence is show below: PTAAFLLPPSTACCTQLYRKPLSDKLLRKVIRVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPNLNFGMLRKMG.
For Research Use Only | Not For Clinical Use.
Online Inquiry