AibGenesis™ Mouse Anti-CCL27 Antibody (CBMOAB-38538FYA)
Cat: CBMOAB-38538FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-38538FYA | Monoclonal | Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Rat (Rattus norvegicus) | WB, ELISA | MO38538FYA | 100 µg | ||
| MO-AB-24584H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24584C | 100 µg | ||
| MO-AB-29411W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29411W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Rat (Rattus norvegicus) |
| Clone | MO38538FYA |
| Specificity | This antibody binds to Rhesus CCL27. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus CCL27 Antibody is a mouse antibody against CCL27. It can be used for CCL27 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | C-C motif chemokine 27; CCL27 |
| UniProt ID | H9F6B3 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: PTAAFLLPPSTACCTQLYRKPLSDKLLRKVIRVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPNLNFGMLRKMG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry