Mouse Anti-CCL4 Antibody (MO-AB-52456W)
Cat: MO-AB-52456W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-52456W | Monoclonal | Marmoset, Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO52456W | 100 µg | ||
CBMOAB-38539FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO38539FYA | 100 µg | ||
MO-AB-27014W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO27014W | 100 µg | ||
MO-AB-29416W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29416W | 100 µg | ||
MO-AB-34499W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34499W | 100 µg | ||
MO-AB-43931W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43931W | 100 µg | ||
MO-AB-09702R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09702R | 100 µg | ||
MO-AB-24589H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24589C | 100 µg | ||
MO-AB-01019Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01019Y | 100 µg | ||
MO-AB-06348Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06348Y | 100 µg | ||
MO-AB-07468Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07468Y | 100 µg | ||
MO-AB-10827Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10827Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Marmoset, Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
Clone | MO52456W |
Specificity | This antibody binds to Marmoset CCL4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Marmoset CCL4 Antibody is a mouse antibody against CCL4. It can be used for CCL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | C-C motif chemokine; CCL4 |
UniProt ID | U3F7H0 |
Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MKLCMTVLSLLVLVAAFCSPALSAPMGSDPPTACCFSYTVRKLPRNFVVDYFETSSLCSQPAVVFQTKRGKQVCADPSETWVQEYVYDLELN. |
See other products for " CCL4 "
MOFY-0622-FY201 | Rabbit Anti-CCL4 Antibody (MOFY-0622-FY201) |
MOFY-0722-FY199 | FITC conjugated antibody to CCL4 Antibody (MOFY-0722-FY199) |
MOFY-0722-FY434 | Rabbit Anti-CCL4 Antibody (MOFY-0722-FY434) |
For Research Use Only | Not For Clinical Use.
Online Inquiry