Mouse Anti-CCL5 Antibody (CBMOAB-38550FYA)


Cat: CBMOAB-38550FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38550FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Mouse, Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus, Human, Sheep (Ovis aries) WB, ELISA MO38550FYA 100 µg
MO-AB-00188L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00188L 100 µg
MO-AB-07469Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07469Y 100 µg
MO-AB-08665W Monoclonal Cat (Felis catus) WB, ELISA MO08665W 100 µg
MO-AB-09703R Monoclonal Cattle (Bos taurus) WB, ELISA MO09703R 100 µg
MO-AB-14481Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14481Y 100 µg
MO-AB-19598W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19598W 100 µg
MO-AB-24390R Monoclonal Pig (Sus scrofa) WB, ELISA MO24390R 100 µg
MO-AB-24591H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24591C 100 µg
MO-AB-29418W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29418W 100 µg
MO-AB-34501W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34501W 100 µg
MO-AB-41357W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41357W 100 µg
MO-AB-43932W Monoclonal Horse (Equus caballus) WB, ELISA MO43932W 100 µg
MOFY-0622-FY9 Monoclonal Guinea pig WB, IHC, ICC, IP 100 µg
MOFY-0622-FY81 Polyclonal Guinea pig WB, IHC, ICC, IP 100 µg
MOFY-0722-FY115 Polyclonal Rhesus WB, IHC, ICC 100 µg
MOFY-0722-FY190 Polyclonal Dog WB, IHC, ICC, IF 100 µg
MOFY-0722-FY230 Polyclonal Dog, Mouse WB, IHC, ICC, IP 100 µg
MOFY-0722-FY441 Polyclonal Rhesus WB, IHC, ICC, IF 100 µg
MOFY-0722-FY77 Polyclonal Rhesus, Human WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Mouse, Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus, Human, Sheep (Ovis aries)
CloneMO38550FYA
SpecificityThis antibody binds to Rhesus CCL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL5 (C-C Motif Chemokine Ligand 5) is a Protein Coding gene. Diseases associated with CCL5 include Ulcer Of Lower Limbs and Periapical Granuloma. Among its related pathways are PEDF Induced Signaling and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and chemokine activity. An important paralog of this gene is CCL3L3.
Product OverviewMouse Anti-Rhesus CCL5 Antibody is a mouse antibody against CCL5. It can be used for CCL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChemokine ligand 5; CCL5
UniProt IDA0MK18
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: MKVSVAALAVILVATALCAPASASPHASDTTPCCFAYIARPLPRAHIKEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXKWVREYINSLEMS.
For Research Use Only | Not For Clinical Use.
Online Inquiry