Mouse Anti-CCL5 Antibody (CBMOAB-38550FYA)
Cat: CBMOAB-38550FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-38550FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Mouse, Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus, Human, Sheep (Ovis aries) | WB, ELISA | MO38550FYA | 100 µg | ||
MO-AB-00188L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00188L | 100 µg | ||
MO-AB-07469Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07469Y | 100 µg | ||
MO-AB-08665W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08665W | 100 µg | ||
MO-AB-09703R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09703R | 100 µg | ||
MO-AB-14481Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14481Y | 100 µg | ||
MO-AB-19598W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19598W | 100 µg | ||
MO-AB-24390R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24390R | 100 µg | ||
MO-AB-24591H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24591C | 100 µg | ||
MO-AB-29418W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29418W | 100 µg | ||
MO-AB-34501W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34501W | 100 µg | ||
MO-AB-41357W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41357W | 100 µg | ||
MO-AB-43932W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43932W | 100 µg | ||
MOFY-0622-FY9 | Monoclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY81 | Polyclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY115 | Polyclonal | Rhesus | WB, IHC, ICC | 100 µg | |||
MOFY-0722-FY190 | Polyclonal | Dog | WB, IHC, ICC, IF | 100 µg | |||
MOFY-0722-FY230 | Polyclonal | Dog, Mouse | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY441 | Polyclonal | Rhesus | WB, IHC, ICC, IF | 100 µg | |||
MOFY-0722-FY77 | Polyclonal | Rhesus, Human | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Mouse, Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus, Human, Sheep (Ovis aries) |
Clone | MO38550FYA |
Specificity | This antibody binds to Rhesus CCL5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CCL5 (C-C Motif Chemokine Ligand 5) is a Protein Coding gene. Diseases associated with CCL5 include Ulcer Of Lower Limbs and Periapical Granuloma. Among its related pathways are PEDF Induced Signaling and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and chemokine activity. An important paralog of this gene is CCL3L3. |
Product Overview | Mouse Anti-Rhesus CCL5 Antibody is a mouse antibody against CCL5. It can be used for CCL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Chemokine ligand 5; CCL5 |
UniProt ID | A0MK18 |
Protein Refseq | The length of the protein is 91 amino acids long. The sequence is show below: MKVSVAALAVILVATALCAPASASPHASDTTPCCFAYIARPLPRAHIKEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXKWVREYINSLEMS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry