AibGenesis™ Mouse Anti-ccnc Antibody (CBMOAB-69544FYA)


Cat: CBMOAB-69544FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69544FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO69544FYA 100 µg
MO-AB-09715R Monoclonal Cattle (Bos taurus) WB, ELISA MO09715R 100 µg
MO-AB-12168W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12168W 100 µg
MO-AB-52465W Monoclonal Marmoset WB, ELISA MO52465W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO69544FYA
SpecificityThis antibody binds to Zebrafish ccnc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ccnc Antibody is a mouse antibody against ccnc. It can be used for ccnc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin C; Zgc:73078 protein; ccnc; CCNC zgc:7307
UniProt IDQ6STL0
Protein RefseqThe length of the protein is 283 amino acids long.
The sequence is show below: MAGNFWQSSHYLQWVLDKQDLMKERQKDLKFLTEEEYWKLQIFFANVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPFRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYDQWKNFDDRKEIAAVLNKVPKPKPPPNSETDQSSNGSQNSSYSQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry