AibGenesis™ Mouse Anti-CCNL2 Antibody (MO-AB-01545W)


Cat: MO-AB-01545W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01545W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO01545W 100 µg
MO-AB-02181H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02181C 100 µg
MO-AB-09729R Monoclonal Cattle (Bos taurus) WB, ELISA MO09729R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO01545W
SpecificityThis antibody binds to Rhesus CCNL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CCNL2 Antibody is a mouse antibody against CCNL2. It can be used for CCNL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin-L2 isoform B; CCNL2
UniProt IDH9F8E0
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: GAPGSGGAPSGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCELIQAAGILLRLPQVAMATGQGLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHRLRQLREKKKPVPLLLDQDYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQHLVQTSWVASEGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry