Mouse Anti-CD160 Antibody (CBMOAB-38623FYA)


Cat: CBMOAB-38623FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38623FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO38623FYA 100 µg
MO-AB-24608H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24608C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO38623FYA
SpecificityThis antibody binds to Rhesus CD160.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CD160 Antibody is a mouse antibody against CD160. It can be used for CD160 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD160
UniProt IDF7HQP2
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: MLMETGRGCCALAILLAIVDIQSGGCINITSSAFQEGTQLNLICTVWHKKEEAEGLVVFLCKDKSRDCFPETSLKQLRLKRDPGIDGVGEISSELVFTISQVTPSHSGTYQCCATSQKSGIRLQGHFFSLLVTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVVLQAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry