Mouse Anti-CD19 Antibody (MO-AB-09782R)
Cat: MO-AB-09782R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-09782R | Monoclonal | Cattle (Bos taurus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO09782R | 100 µg | ||
| MO-AB-41362W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41362W | 100 µg | ||
| MO-AB-43981W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43981W | 100 µg | ||
| MO-AB-52537W | Monoclonal | Marmoset | WB, ELISA | MO52537W | 100 µg | ||
| MO-AB-24613H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24613C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO09782R |
| Specificity | This antibody binds to Cattle CD19. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CD19 (CD19 Molecule) is a Protein Coding gene. Diseases associated with CD19 include Immunodeficiency, Common Variable, 3 and Common Variable Immunodeficiency. Among its related pathways are RET signaling and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include signal transducer activity, downstream of receptor. |
| Product Overview | Mouse Anti-Cattle CD19 Antibody is a mouse antibody against CD19. It can be used for CD19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CD19; CD19 |
| UniProt ID | C9EGS9 |
| Protein Refseq | The length of the protein is 568 amino acids long. The sequence is show below: MPPPLLFLLLFLTPVGVRPEDPRLVEAKEGGDTVLPCLEGSSAGPPEQLAWFRGSQTTPFLNLSLGLPGLGIHVGPLGTLKEPQGTLLFLFNVSKHMGGFYLCQPGLSSEQGWQPSWTVSVQGSGKLFRWNASDLNDPSCDLRNKTSKGPRSSSGHPTKSQLNVWGTDHFKEISHADLPCAPPNSTLNHSDNRDLTVAPGSTLLLSCGASHTSLVRGSVSWIHKYPMKPEVKLLSLYVSEHAQLREMWVMGTLGG. |
Reference
| Reference | 1. Zhao, H., Tang, X., Wu, M., Li, Q., Yi, X., Liu, S., ... & Sun, X. (2021). Transcriptome characterization of short distance transport stress in beef cattle blood. Frontiers in Genetics, 12, 616388. 2. Pringle, E. S., Firth, M. A., Chattha, K. S., Hodgins, D. C., & Shewen, P. E. (2012). Expression of complement receptors 1 (CR1/CD35) and 2 (CR2/CD21), and co-signaling molecule CD19 in cattle. Developmental & Comparative Immunology, 38(4), 487-494. 3. Sopp, P., Kwong, L. S., & Howard, C. J. (2001). Cross-reactivity with bovine cells of monoclonal antibodies submitted to the 6th International Workshop on Human Leukocyte Differentiation Antigens. Veterinary immunology and immunopathology, 78(2), 197-206. |
See other products for " CD19 "
| CBMOAB-38636FYA | Mouse Anti-CD19 Antibody (CBMOAB-38636FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry