Mouse Anti-CD19 Antibody (MO-AB-09782R)


Cat: MO-AB-09782R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09782R Monoclonal Cattle (Bos taurus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09782R 100 µg
MO-AB-41362W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41362W 100 µg
MO-AB-43981W Monoclonal Horse (Equus caballus) WB, ELISA MO43981W 100 µg
MO-AB-52537W Monoclonal Marmoset WB, ELISA MO52537W 100 µg
MO-AB-24613H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24613C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus)
CloneMO09782R
SpecificityThis antibody binds to Cattle CD19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CD19 Antibody is a mouse antibody against CD19. It can be used for CD19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD19; CD19
UniProt IDC9EGS9
Protein RefseqThe length of the protein is 568 amino acids long.
The sequence is show below: MPPPLLFLLLFLTPVGVRPEDPRLVEAKEGGDTVLPCLEGSSAGPPEQLAWFRGSQTTPFLNLSLGLPGLGIHVGPLGTLKEPQGTLLFLFNVSKHMGGFYLCQPGLSSEQGWQPSWTVSVQGSGKLFRWNASDLNDPSCDLRNKTSKGPRSSSGHPTKSQLNVWGTDHFKEISHADLPCAPPNSTLNHSDNRDLTVAPGSTLLLSCGASHTSLVRGSVSWIHKYPMKPEVKLLSLYVSEHAQLREMWVMGTLGG.

Reference

Reference1. Zhao, H., Tang, X., Wu, M., Li, Q., Yi, X., Liu, S., ... & Sun, X. (2021). Transcriptome characterization of short distance transport stress in beef cattle blood. Frontiers in Genetics, 12, 616388.
2. Pringle, E. S., Firth, M. A., Chattha, K. S., Hodgins, D. C., & Shewen, P. E. (2012). Expression of complement receptors 1 (CR1/CD35) and 2 (CR2/CD21), and co-signaling molecule CD19 in cattle. Developmental & Comparative Immunology, 38(4), 487-494.
3. Sopp, P., Kwong, L. S., & Howard, C. J. (2001). Cross-reactivity with bovine cells of monoclonal antibodies submitted to the 6th International Workshop on Human Leukocyte Differentiation Antigens. Veterinary immunology and immunopathology, 78(2), 197-206.
See other products for " CD19 "
For Research Use Only | Not For Clinical Use.
Online Inquiry