Mouse Anti-CD1B Antibody (CBMOAB-38640FYA)


Cat: CBMOAB-38640FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38640FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Rabbit (Oryctolagus cuniculus) WB, ELISA MO38640FYA 100 µg
MO-AB-29447W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29447W 100 µg
MO-AB-07518Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07518Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Rabbit (Oryctolagus cuniculus)
CloneMO38640FYA
SpecificityThis antibody binds to Rhesus CD1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD1B (CD1b Molecule) is a Protein Coding gene. Diseases associated with CD1B include Mycobacterium Malmoense and Mycobacterium Tuberculosis 1. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. Gene Ontology (GO) annotations related to this gene include beta-2-microglobulin binding and endogenous lipid antigen binding. An important paralog of this gene is CD1A.
Product OverviewMouse Anti-Rhesus CD1B Antibody is a mouse antibody against CD1B. It can be used for CD1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD1B
UniProt IDF7D531
Protein RefseqThe length of the protein is 333 amino acids long.
The sequence is show below: MLLLPFQLLAVLFPGGDSERAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAILLKPWSKGNFSDKEFAELEEIFRVYIFGFAQEVQDFAGDFQIQYPFEIQGIAGCELHSGGAIVSFLRGALRGLDFLSVKNASCVPSPEGGSKAQKVCALIMQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMQDEQEQRGTQLGDILPNANWTWYLRATLDVAAGEAAGLSCRVKHSSLQGQDIVLYWRNPTSTGSIVLAIMVPSLLLLLCLALWYMRRRSYQNIP.
For Research Use Only | Not For Clinical Use.
Online Inquiry