Mouse Anti-CD1C Antibody (CBMOAB-38641FYA)


Cat: CBMOAB-38641FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38641FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Horse (Equus caballus) WB, ELISA MO38641FYA 100 µg
MO-AB-29450W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29450W 100 µg
MO-AB-43991W Monoclonal Horse (Equus caballus) WB, ELISA MO43991W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Horse (Equus caballus)
CloneMO38641FYA
SpecificityThis antibody binds to Rhesus CD1C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD1C (CD1c Molecule) is a Protein Coding gene. Diseases associated with CD1C include Mycobacterium Malmoense and Foramen Magnum Meningioma. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Innate Immune System. Gene Ontology (GO) annotations related to this gene include beta-2-microglobulin binding and lipopeptide binding. An important paralog of this gene is CD1B.
Product OverviewMouse Anti-Rhesus CD1C Antibody is a mouse antibody against CD1C. It can be used for CD1C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD1c; CD1C
UniProt IDB9X0T6
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: MLFLQFLLLAVLSGGDNADAQEHVSFYTIQILSFANQSWAQSQGSGWLDELQTHGWESESGRIIFLHTWSKSNFSNEELSDLELLFRVYFFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKNPEGFFRVAFNGLDLLSFQNTTWVPSPDGGSLAPGVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYLHRQVRPEAWLSSRRSLGSGRLLLVCHASGFYPKPVWVTWMRNEQEQVGTKHGDVLPNADGTWYLQVILEVASEETAGLSCRVRHSSLGGQDIILYWGHHFSMNWIALIVLVSLVILIVLVLRFKKHCSYQDIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry