Mouse Anti-CD2 Antibody (CBMOAB-38655FYA)


Cat: CBMOAB-38655FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38655FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Tomato (Lycopersicon esculentum) WB, ELISA MO38655FYA 100 µg
CBMOAB-00031FYA Monoclonal Cattle (Bos taurus) FC F00031FYA 100 µg
CBMOAB-00152FYA Monoclonal Horse (Equus caballus) FC F00152FYA 100 µg
MO-AB-09106W Monoclonal Cat (Felis catus) WB, ELISA MO09106W 100 µg
MO-AB-23640W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23640W 100 µg
MO-AB-52538W Monoclonal Marmoset WB, ELISA MO52538W 100 µg
MO-AB-09795R Monoclonal Cattle (Bos taurus) WB, ELISA MO09795R 100 µg
MO-AB-34256H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34256C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Tomato (Lycopersicon esculentum)
CloneMO38655FYA
SpecificityThis antibody binds to Rhesus CD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD2 (CD2 Molecule) is a Protein Coding gene. Diseases associated with CD2 include Penis Squamous Cell Carcinoma and Immune Defect Due To Absence Of Thymus. Among its related pathways are PEDF Induced Signaling and Akt Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and receptor activity.
Product OverviewMouse Anti-Rhesus CD2 Antibody is a mouse antibody against CD2. It can be used for CD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCluster of differentiation 2; CD2
UniProt IDQ6SZ60
Protein RefseqThe length of the protein is 342 amino acids long.
The sequence is show below: SFLLIFNVSSKGAVSKEIRNALETWGALGQDIDLDIPSFQMSDDIDDIRWEKTSDKKKIAQFRKEKETFEEKDAYKLFKNGTLKXKHLKIHDQDSYKVSIYDTKGKNVLEKTFDLKIQERVSEPKISWTCINTTLTCEVMNGTXPELNLYQDGKHVKLSQRVITHKWTTSLSAKFKCTAGNKVSKESRMETVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELEIRAHRVATEERGRKPHQIPASTPQNPAASQHPPPPPGHRSQAPSHRPLPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPQGAAENSLSPSSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry