Mouse Anti-CD226 Antibody (CBMOAB-38673FYA)


Cat: CBMOAB-38673FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38673FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Zebrafish (Danio rerio) WB, ELISA MO38673FYA 100 µg
CBMOAB-69667FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69667FYA 100 µg
MO-AB-15521W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15521W 100 µg
MO-DKB-01254W Polyclonal Human (Homo sapiens), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Zebrafish (Danio rerio)
CloneMO38673FYA
SpecificityThis antibody binds to Rhesus CD226.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD226 (CD226 Molecule) is a Protein Coding gene. Diseases associated with CD226 include Ovarian Cystic Teratoma and Mature Teratoma Of The Ovary. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and Innate Immune System. Gene Ontology (GO) annotations related to this gene include protein kinase binding and cell adhesion molecule binding.
Product OverviewMouse Anti-Rhesus CD226 Antibody is a mouse antibody against CD226. It can be used for CD226 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD226 antigen; CD226
UniProt IDF7H8I4
Protein RefseqThe length of the protein is 336 amino acids long.
The sequence is show below: MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSVGILTQVEWFKIGTEKDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDGFEAAVPPNSHIVSEPGKNITLTCQPQMTWPVQEVRWEKIQPHQIDLLTYCDLVHGRNFTSKFPRQIVSNCSHGSWSFIVVPDVTASDSGLYRCHLQASAGENETFVMRLTVAEGQTDNQYTRFVTGGTVLLLLFVISITTIIVIFLNRRRRRERNDLYTESWDTQKAPKNYRSPISANQPTNQSMDDTREDIYVNYPTFSRRPKTRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry