Mouse Anti-CD244 Antibody (CBMOAB-38677FYA)


Cat: CBMOAB-38677FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38677FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset WB, ELISA MO38677FYA 100 µg
MO-AB-01047Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01047Y 100 µg
MO-AB-52543W Monoclonal Marmoset WB, ELISA MO52543W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset
CloneMO38677FYA
SpecificityThis antibody binds to Rhesus CD244.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD244 (CD244 Molecule) is a Protein Coding gene. Diseases associated with CD244 include Rheumatoid Arthritis and Lymphoproliferative Syndrome, X-Linked, 1. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include receptor activity.
Product OverviewMouse Anti-Rhesus CD244 Antibody is a mouse antibody against CD244. It can be used for CD244 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD244
UniProt IDF7HDM4
Protein RefseqThe length of the protein is 273 amino acids long.
The sequence is show below: MLEQVVTFTLLLLLKGYQGKGCQGSADNVFSILGMPLQLQPNSIQTKIYNVQWKMWLPSQNTFRQILQWENGSSPSNTFNNRFSFIIKNSTLLIKAAQQQDSGLYCLEVTNTMGQVQRAMFQVFVFEFRFWPFLVIIVILSTLFLGTLVCFCVWRRKRKGKQSETCPKEFLTIYEEVKDLKTRRNKEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQLSKKPGSRKRNHSPSFNSTIYEVIEKSQPKAQNPARLSRKELKNFDVYS.
For Research Use Only | Not For Clinical Use.
Online Inquiry