Mouse Anti-CD274 Antibody (CBMOAB-38680FYA)


Cat: CBMOAB-38680FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38680FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Mouse (Mus musculus) WB, ELISA MO38680FYA 100 µg
MO-AB-09803R Monoclonal Cattle (Bos taurus) WB, ELISA MO09803R 100 µg
MO-AB-22638W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22638W 100 µg
MO-AB-29456W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29456W 100 µg
MO-AB-52544W Monoclonal Marmoset WB, ELISA MO52544W 100 µg
MO-AB-70616W Monoclonal Mouse (Mus musculus) In vivo study 3H9G2 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Mouse (Mus musculus)
CloneMO38680FYA
SpecificityThis antibody binds to Rhesus CD274.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations; Plasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CD274 Antibody is a mouse antibody against CD274. It can be used for CD274 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD274
UniProt IDF6PJN1
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MRIFAVFIFTIYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry