Mouse Anti-CD320 Antibody (CBMOAB-38694FYA)


Cat: CBMOAB-38694FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38694FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO38694FYA 100 µg
MO-AB-09816R Monoclonal Cattle (Bos taurus) WB, ELISA MO09816R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO38694FYA
SpecificityThis antibody binds to Rhesus CD320.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD320 (CD320 Molecule) is a Protein Coding gene. Diseases associated with CD320 include Methylmalonic Aciduria, Transient, Due To Transcobalamin Receptor Defect and Methylmalonic Acidemia Due To Transcobalamin Receptor Defect. Among its related pathways are Diseases of metabolism and Metabolism. Gene Ontology (GO) annotations related to this gene include growth factor activity and cobalamin binding.
Product OverviewMouse Anti-Rhesus CD320 Antibody is a mouse antibody against CD320. It can be used for CD320 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD320
UniProt IDF6VLQ2
Protein RefseqThe length of the protein is 280 amino acids long.
The sequence is show below: TSGWMARGGAQRTGALGLALRLLLGLGLGLEVAATPLSTRTSAQASGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDFDCSDGSDEEECRIEPCTQNGQCPPPPGLPCPCTGVSDCSGRTDKKLRNCSRPACPAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTHLRGPGAVAHTCNPSTLGGRGSLRDATTTGPPATPESVTSVGNVTSSSAGDQSGSSGVYGVIAAAAVLSASLVAVTLLLLSWLRAQERLRPLGLLVAMKESLLLSERKTSLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry