Mouse Anti-CD34 Antibody (CBMOAB-38697FYA)


Cat: CBMOAB-38697FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38697FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Human (Homo sapiens), Zebrafish (Danio rerio), Human, Mouse, Rat, Dog, Marmoset WB, ELISA MO38697FYA 100 µg
MO-AB-01559W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01559W 100 µg
MO-AB-09014W Monoclonal Cat (Felis catus) WB, ELISA MO09014W 100 µg
MO-AB-09817R Monoclonal Cattle (Bos taurus) WB, ELISA MO09817R 100 µg
MO-AB-29461W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29461W 100 µg
MO-AB-52557W Monoclonal Marmoset WB, ELISA MO52557W 100 µg
MO-DKB-00331W Polyclonal Human (Homo sapiens), Zebrafish (Danio rerio) WB, ICC, IHC-P, FC 100 µg
MOF032922W133 Polyclonal Human, Mouse, Rat, Dog WB, IHC-P, ICC/IF, IP, FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Human (Homo sapiens), Zebrafish (Danio rerio), Human, Mouse, Rat, Dog, Marmoset
CloneMO38697FYA
SpecificityThis antibody binds to Rhesus CD34.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CD34 Antibody is a mouse antibody against CD34. It can be used for CD34 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD34
UniProt IDF6UKW3
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MDFHPWRLCRFFYCVVAHIQLAVFFFVGILERRMLLVDGAEFRKDRGEDLARVLCGEEQADADAGAQICSLLLAQSEVRPQCLLLVLANRTDVASQIQRDHSLEPKMLGILGFTEQDVASHQSYSRKTLIALVTSGTLLAILGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry