Mouse Anti-CD3D Antibody (CBMOAB-38699FYA)


Cat: CBMOAB-38699FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38699FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Ovis aries, Sheep, Pig, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO38699FYA 100 µg
MO-AB-01055Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01055Y 100 µg
MO-AB-09823R Monoclonal Cattle (Bos taurus) WB, ELISA MO09823R 100 µg
MO-AB-14496Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14496Y 100 µg
MO-AB-24451R Monoclonal Pig (Sus scrofa) WB, ELISA MO24451R 100 µg
MO-AB-24636H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24636C 100 µg
MOFY-0622-FY158 Polyclonal Ovis aries, Sheep WB, IHC, ICC, IP 100 µg
MOFY-0722-FY287 Polyclonal Pig WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Ovis aries, Sheep, Pig, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO38699FYA
SpecificityThis antibody binds to Rhesus CD3D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD3D (CD3d Molecule) is a Protein Coding gene. Diseases associated with CD3D include Immunodeficiency 19 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta/Cd3epsilon/Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and transmembrane signaling receptor activity. An important paralog of this gene is CD3G.
Product OverviewMouse Anti-Rhesus CD3D Antibody is a mouse antibody against CD3D. It can be used for CD3D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD3D
UniProt IDF6WI60
Protein RefseqThe length of the protein is 171 amino acids long.
The sequence is show below: MEHSTFLSGLVLATLLSQVSPFKIPVEELEDRVFVKCNTSVTWVEGTMGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSRLGGNWARNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry