Mouse Anti-CD40 Antibody (MO-AB-52561W)


Cat: MO-AB-52561W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-52561W Monoclonal Marmoset, Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO52561W 100 µg
CBMOAB-00056FYA Monoclonal Cattle (Bos taurus) FC F00056FYA 100 µg
MO-AB-01561W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01561W 100 µg
MO-AB-29469W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29469W 100 µg
MO-AB-43999W Monoclonal Horse (Equus caballus) WB, ELISA MO43999W 100 µg
MO-AB-09836R Monoclonal Cattle (Bos taurus) WB, ELISA MO09836R 100 µg
MO-AB-24640H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24640C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO52561W
SpecificityThis antibody binds to Marmoset CD40.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD40 (CD40 Molecule) is a Protein Coding gene. Diseases associated with CD40 include Immunodeficiency With Hyper-Igm, Type 3 and Cd40 Ligand Deficiency. Among its related pathways are NLR Proteins and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include enzyme binding and receptor activity. An important paralog of this gene is TNFRSF11A.
Product OverviewMouse Anti-Marmoset CD40 Antibody is a mouse antibody against CD40. It can be used for CD40 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTumor necrosis factor receptor superfamily member 5; CD40
UniProt IDF7I7Y6
Protein RefseqThe length of the protein is 275 amino acids long.
The sequence is show below: MFRLPLQCVLWGCLLSSVHPEPPTACREKQYLINSQCCSLCQPGWKLVNDCTEVTETECLPCGKGEFLDTWNRETHCHQHKYCDPNLGLRVQQEGTSVTDNICVCKEGRHCTSKACESCVLYHSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSKCETKGLAEQQAGTDKTDAVCGPQNRLRLLVLIPIMLGILFAILLVLVFIKKVDRKPQDKAPCTKQIPQEIDDLPGPNPTPPVQETLHGCQPVAQEDGKESRISVQERQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry