Mouse Anti-CD46 Antibody (CBMOAB-38718FYA)


Cat: CBMOAB-38718FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38718FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Marmoset, Sheep (Ovis aries) WB, ELISA MO38718FYA 100 µg
MO-AB-19690W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19690W 100 µg
MO-AB-41373W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41373W 100 µg
MO-AB-52568W Monoclonal Marmoset WB, ELISA MO52568W 100 µg
MO-AB-09853R Monoclonal Cattle (Bos taurus) WB, ELISA MO09853R 100 µg
MO-AB-14504Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14504Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Marmoset, Sheep (Ovis aries)
CloneMO38718FYA
SpecificityThis antibody binds to Rhesus CD46.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD46 (CD46 Molecule) is a Protein Coding gene. Diseases associated with CD46 include Hemolytic Uremic Syndrome, Atypical 2 and Measles. Among its related pathways are Creation of C4 and C2 activators and Complement and coagulation cascades. Gene Ontology (GO) annotations related to this gene include receptor activity and enzyme inhibitor activity. An important paralog of this gene is C4BPA.
Product OverviewMouse Anti-Rhesus CD46 Antibody is a mouse antibody against CD46. It can be used for CD46 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD46
UniProt IDF7DTG7
Protein RefseqThe length of the protein is 399 amino acids long.
The sequence is show below: MASSGRRERPFSSGRFPGLLLATLVLQLSSFSDACEAPPTFEAMELIGKPKPYYRVGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFGAELHFICNEGYYLIGKDILYCELKDTVAIWSGKPPLCEKILCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKVLPPSSTKSPTLSDSVSTSPTTKSPTSSASGPRPTYKPPVSNYPGYPKPDEGILNNLDDWVIALIVIVIVVAVAVICVALYRFLQGRKKKGKADGGPEYATYQMKSTPPAEQRG.
For Research Use Only | Not For Clinical Use.
Online Inquiry