AibGenesis™ Mouse Anti-CD99L2 Antibody (CBMOAB-38757FYA)


Cat: CBMOAB-38757FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38757FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO38757FYA 100 µg
CBMOAB-69728FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69728FYA 100 µg
MO-AB-09895R Monoclonal Cattle (Bos taurus) WB, ELISA MO09895R 100 µg
MO-AB-24665H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24665C 100 µg
MO-AB-25905W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25905W 100 µg
MO-AB-52615W Monoclonal Marmoset WB, ELISA MO52615W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO38757FYA
SpecificityThis antibody binds to Rhesus CD99L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CD99L2 Antibody is a mouse antibody against CD99L2. It can be used for CD99L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD99L2
UniProt IDF6TXJ6
Protein RefseqThe length of the protein is 212 amino acids long.
The sequence is show below: MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSIKQKWNQVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSDDDPGSGTVAETGTIAGVVSALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSALHTQSAEPPPPEPARI.
For Research Use Only | Not For Clinical Use.
Online Inquiry