Mouse Anti-CDC16 Antibody (MO-AB-24512R)
Cat: MO-AB-24512R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-24512R | Monoclonal | Pig (Sus scrofa), Barrel medic (Medicago truncatula), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO24512R | 100 µg | ||
| CBMOAB-03236FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO03236FYA | 100 µg | ||
| CBMOAB-38773FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO38773FYA | 100 µg | ||
| CBMOAB-69760FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO69760FYA | 100 µg | ||
| MO-AB-00091W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00091W | 100 µg | ||
| MO-AB-20932W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20932W | 100 µg | ||
| MO-AB-02223H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02223C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Pig (Sus scrofa), Barrel medic (Medicago truncatula), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO24512R |
| Specificity | This antibody binds to Pig CDC16. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | This product is a mouse antibody against CDC16. It can be used for CDC16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cell division cycle 16-like protein, Fragment; CDC16 |
| UniProt ID | Q3HNA9 |
| Protein Refseq | The length of the protein is 52 amino acids long. The sequence is show below: QENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKGPFHANCLPVHIGTLVELN. |
See other products for " CDC16 "
| CBMOAB-00655CR | Mouse Anti-CDC16 Antibody (CBMOAB-00655CR) |
For Research Use Only | Not For Clinical Use.
Online Inquiry