AibGenesis™ Mouse Anti-cdc42ep3 Antibody (CBMOAB-69794FYA)


Cat: CBMOAB-69794FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69794FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO69794FYA 100 µg
MO-AB-02243H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02243C 100 µg
MO-AB-09923R Monoclonal Cattle (Bos taurus) WB, ELISA MO09923R 100 µg
MO-AB-21264W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21264W 100 µg
MO-AB-24672H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24672C 100 µg
MO-AB-52640W Monoclonal Marmoset WB, ELISA MO52640W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO69794FYA
SpecificityThis antibody binds to Zebrafish cdc42ep3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cdc42ep3 Antibody is a mouse antibody against cdc42ep3. It can be used for cdc42ep3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92806; cdc42ep3; zgc:92806; NP_001004568.
UniProt IDQ66HU1
Protein RefseqThe length of the protein is 300 amino acids long.
The sequence is show below: MPAKTPIYLKSNYSKKGKKCRLRDILSPDMISPPLGDFRHTIHIGKGGECDAFGDMSFLQGNFELLPGKGGRVRPQYGLHGEFTRANSASDASYVETPSPVLKNAISLPTIGGSQALTLPMISTTVFPMTHDNMSEPSTPPAGSEDLEILQMETLLQSISIFRSDPSPVPEEDEPMIDRMEMNEKSCMKKMHSSEKELETFLSVFVNGNGDANGNFNNGNNGDSVFQYEQDMFSIKGDWADRDSGVEEGRLCDSDFEISKSKSQSQESLPQITGSLFSLELDLGPSILDDVLNIMNKPVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry