AibGenesis™ Mouse Anti-cdc42ep5 Antibody (CBMOAB-69800FYA)


Cat: CBMOAB-69800FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-69800FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO69800FYA 100 µg
MO-AB-21987W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21987W 100 µg
MO-AB-24673H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24673C 100 µg
MO-AB-52643W Monoclonal Marmoset WB, ELISA MO52643W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO69800FYA
SpecificityThis antibody binds to Zebrafish cdc42ep5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cdc42ep5 Antibody is a mouse antibody against cdc42ep5. It can be used for cdc42ep5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:153966; cdc42ep5; cdc42ep1 cdc42ep1b zgc:15396
UniProt IDQ0P3U5
Protein RefseqThe length of the protein is 295 amino acids long.
The sequence is show below: MPLHKSSRAPRLDPTMISAPLGDFRHTMHIGRGGDAFGDTSFLSSHGPSSPDPSTAQPVTATPSMTENQDIETNHNDEMKYVEDSSPSELRHSDSVSSFDLDLDLGPSILGDVLGVMDGLTMGSCKGNEEVFTSGSKDAMMSSRNVGNELNERMRMESLSRELRDEQLNEVNGIKSKGLRPKVRFSDKRDEIIGRQEVIEGLEAEGEEMRPNKGMQEISGRTAFDKDPRQEEMVNRREENSPSLSSSASSEYEGVSPLDRRREDQHLSDSDSEEETANGEQGYTFEDELDDEIGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry