Mouse Anti-CDCA5 Antibody (MO-AB-09934R)


Cat: MO-AB-09934R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09934R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rhesus (Macaca mulatta) WB, ELISA MO09934R 100 µg
CBMOAB-38810FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO38810FYA 100 µg
MO-AB-23849W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23849W 100 µg
MO-AB-02257H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02257C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rhesus (Macaca mulatta)
CloneMO09934R
SpecificityThis antibody binds to Cattle CDCA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCDCA5 (Cell Division Cycle Associated 5) is a Protein Coding gene. Diseases associated with CDCA5 include Cornelia De Lange Syndrome. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Cell Cycle, Mitotic. Gene Ontology (GO) annotations related to this gene include chromatin binding.
Product OverviewMouse Anti-Cattle CDCA5 Antibody is a mouse antibody against CDCA5. It can be used for CDCA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCell division cycle associated 5; CDCA5
UniProt IDQ2YDF8
Protein RefseqThe length of the protein is 486 amino acids long.
The sequence is show below: MSERRTRSGGAVQCPGPSAPTPTRSLRRSQRKSGSDLPNTLPEVCPKAPQEAPVRKPIVLKKIVAHTVEVRAERGVVGGEPGSGVGCVINSSPQIPSINSPRRSPRIASLLEKENNPPSKKLTKEDLFHTCSVPVTAPSTPVLCPVNAESNSWKGDLDARDLEMSKKVRRSYSRLETLGSASTSTPGRQSCFGFEGLLAAEDLAGVSPVVDSKLAEVPRVSVKPWAPDTTLPGISPLVVKEKRKKKKVPEILCPW.
See other products for " cdca5 "
For Research Use Only | Not For Clinical Use.
Online Inquiry