Mouse Anti-CDH2 Antibody (MO-AB-42989W)
Cat: MO-AB-42989W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-42989W | Monoclonal | Hamsters (Cricetinae), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Marmoset, Sheep (Ovis aries) | WB, ELISA | MO42989W | 100 µg | ||
| MO-AB-16338W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16338W | 100 µg | ||
| MO-AB-44015W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44015W | 100 µg | ||
| MO-AB-52666W | Monoclonal | Marmoset | WB, ELISA | MO52666W | 100 µg | ||
| MO-AB-09950R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO09950R | 100 µg | ||
| MO-AB-14521Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14521Y | 100 µg | ||
| MO-DKB-03593W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Zebrafish (Danio rerio), Cattle (Bos taurus) | WB, ELISA, IHC-P, IHC-Fr, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Hamsters (Cricetinae), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio), Marmoset, Sheep (Ovis aries) |
| Clone | MO42989W |
| Specificity | This antibody binds to Hamsters CDH2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CDH2 (Cadherin 2) is a Protein Coding gene. Diseases associated with CDH2 include Arrhythmogenic Right Ventricular Cardiomyopathy and Malignant Pleural Mesothelioma. Among its related pathways are N-cadherin signaling events and PAK Pathway. Gene Ontology (GO) annotations related to this gene include calcium ion binding and protein phosphatase binding. An important paralog of this gene is CDH4. |
| Product Overview | Mouse Anti-Hamsters CDH2 Antibody is a mouse antibody against CDH2. It can be used for CDH2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cadherin-2; Neural cadherin; N-cadherin; CD antigen CD325; CDH2 |
| UniProt ID | O55075 |
| Protein Refseq | The length of the protein is238 amino acids long. The sequence is show below: TKPLDRELIARFHLRAHAVDINGNRVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVEVIVANLTVTDKDQPHTPAWNAVYRISGGDPTGRFAIHTDPNSNDGLVTVVKPIDFETNRMFV. |
See other products for " CDH2 "
| MO-AB-07541Y | Mouse Anti-CDH2 Antibody (MO-AB-07541Y) |
| CBMOAB-69854FYA | Mouse Anti-cdh2 Antibody (CBMOAB-69854FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry