Mouse Anti-CDK15 Antibody (CBMOAB-38832FYA)


Cat: CBMOAB-38832FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38832FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO38832FYA 100 µg
CBMOAB-69894FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69894FYA 100 µg
MO-AB-25662W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25662W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO38832FYA
SpecificityThis antibody binds to Rhesus CDK15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CDK15 Antibody is a mouse antibody against CDK15. It can be used for CDK15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCDK15
UniProt IDF7D5C2
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MTSFHPRRRQDVRAQKFKSKRPRSNSDSFQEEDLRQSFQWQRKSLPFGAASSYLNLEKLGEGSYATVYKGISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEYMHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKLADFELALCETLNPSTKXSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLFPGVSNIPEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALGHDYFSALPSQLYQLPDGESLGVLSSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry