AibGenesis™ Mouse Anti-CDPF1 Antibody (CBMOAB-38878FYA)
Cat: CBMOAB-38878FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-38878FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO38878FYA | 100 µg | ||
| CBMOAB-69961FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO69961FYA | 100 µg | ||
| MO-AB-10002R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10002R | 100 µg | ||
| MO-AB-24707H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24707C | 100 µg | ||
| MO-AB-52749W | Monoclonal | Marmoset | WB, ELISA | MO52749W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO38878FYA |
| Specificity | This antibody binds to Rhesus CDPF1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CDPF1 (Cysteine Rich DPF Motif Domain Containing 1) is a Protein Coding gene. |
| Product Overview | Mouse Anti-Rhesus CDPF1 Antibody is a mouse antibody against CDPF1. It can be used for CDPF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CDPF1 |
| UniProt ID | F7GE30 |
| Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MASHAECRPPGVFECELCALTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSHKDRFVVLGSRCSLCSRLVCVGPVDSPCAPSHQDGDL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry