Mouse Anti-CEBPB Antibody (CBMOAB-38914FYA)


Cat: CBMOAB-38914FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38914FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO38914FYA 100 µg
CBMOAB-69985FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69985FYA 100 µg
MO-AB-02306H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02306C 100 µg
MO-AB-10031R Monoclonal Cattle (Bos taurus) WB, ELISA MO10031R 100 µg
MO-AB-10873Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10873Y 100 µg
MO-AB-22283W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22283W 100 µg
MO-AB-24556R Monoclonal Pig (Sus scrofa) WB, ELISA MO24556R 100 µg
MO-AB-52765W Monoclonal Marmoset WB, ELISA MO52765W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO38914FYA
SpecificityThis antibody binds to Rhesus CEBPB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
Product OverviewMouse Anti-Rhesus CEBPB Antibody is a mouse antibody against CEBPB. It can be used for CEBPB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCAAT/enhancer-binding protein beta; CEBPB
UniProt IDI2CUK0
Protein RefseqThe length of the protein is 344 amino acids long.
The sequence is show below: MQRLVAWDPACLPLPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPAACYAGAAPPPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC.
For Research Use Only | Not For Clinical Use.
Online Inquiry