Mouse Anti-cebpd Antibody (MO-AB-02307H)


Cat: MO-AB-02307H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02307H Monoclonal Frog (Xenopus laevis), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) WB, ELISA MO02307C 100 µg
CBMOAB-69988FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69988FYA 100 µg
MO-AB-23107W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23107W 100 µg
MO-AB-52766W Monoclonal Marmoset WB, ELISA MO52766W 100 µg
MO-AB-10874Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10874Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio)
CloneMO02307C
SpecificityThis antibody binds to Frog cebpd.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11.
Product OverviewThis product is a mouse antibody against cebpd. It can be used for cebpd detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC398730 protein; cebpd; LOC398730
UniProt IDQ566F4
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: MSLEARCLSPYAAWYMEPTNFYEQRLSGSPAPYKPRGMCEEPEAAVGTGGTLVELSAAPAMYDDESAIDFSSYIDSMASVPNLELCNDELFADLFNSSKAVGERQEGDYLMSGLLAAPHCPPGPAKVQLKQEPEWSDSDMSSSLPNQIAACAQTSMSLQPTPPTSPEPSTSACPSPAASSGSCGKDRSGKKCTDRYSPEYRQRRERNNIAVRKSRDKAKRRNVDMQQRLLELSSENEKLHKKIELLTRDLSSLRHFFKQLPPAATGPFLPSLTGIDCR.
For Research Use Only | Not For Clinical Use.
Online Inquiry