Mouse Anti-cep41 Antibody (CBMOAB-70097FYA)


Cat: CBMOAB-70097FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70097FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO70097FYA 100 µg
MO-AB-10077R Monoclonal Cattle (Bos taurus) WB, ELISA MO10077R 100 µg
MO-AB-24166W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24166W 100 µg
MO-AB-52834W Monoclonal Marmoset WB, ELISA MO52834W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO70097FYA
SpecificityThis antibody binds to Zebrafish cep41.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a centrosomal and microtubule-binding protein which is predicted to have two coiled-coil domains and a rhodanese domain. In human retinal pigment epithelial cells the protein localized to centrioles and cilia. Mutations in this gene have been associated with Joubert Syndrome 15; an autosomal recessive ciliopathy and neurological disorder. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish cep41 Antibody is a mouse antibody against cep41. It can be used for cep41 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCentrosomal protein of 41 kDa; Cep41; Testis-specific gene A14 protein; cep41; tsga1
UniProt IDQ6GQN0
Protein RefseqThe length of the protein is 374 amino acids long.
The sequence is show below: MSVKRGIGDSAFLKKKIPQNPKYQHVKTRLDTGSSLTKYMERLEEARKNYRYRKDELFKRLKVTTFAQLVIQVASVSDQNDNIKDEMAGLEDDVSIFSASPGLDCLSDQTNGSPQPNLPPPQTINIDESGDNGFSPRSTLQSVISGVGELDLDKNGQKTIRLSPVSTSNTTECPYPDCPYLLLDVRDRELYDQCHIVSAYSYPIATLSRTMNPYTKEVLDYKNASGKIIIVYDEDERIASQAATTMCERGFENLFMLSGGLKVVAQKFPEGMTTGSVPISCLPSPTGPAGRKRSAQHQTSQLAEKKWRFTAEDLDKIQHYLEEVFIPSETSSRLSSRMSTSSARSKASTVGSSRQGSSIAGSESARSRSSRPWK.
For Research Use Only | Not For Clinical Use.
Online Inquiry