AibGenesis™ Mouse Anti-CEP72 Antibody (CBMOAB-39048FYA)


Cat: CBMOAB-39048FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39048FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO39048FYA 100 µg
Inquiry
CBMOAB-70117FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70117FYA 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO39048FYA
SpecificityThis antibody binds to Rhesus CEP72.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene is a member of the leucine-rich-repeat (LRR) superfamily of proteins. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus CEP72 Antibody is a mouse antibody against CEP72. It can be used for CEP72 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCentrosomal protein of 72 kDa; CEP72
UniProt IDH9FE25
Protein RefseqThe length of the protein is 87 amino acids long.
The sequence is show below: RTLSKPEASETEEQRSRGMTDTREPSPGSRSALPGKKTTLQAALLETLLDLVDRSWGGCRSLHSNEAFLTQARHILSSVEEFTAAQD.
For Research Use Only | Not For Clinical Use.
Online Inquiry