Mouse Anti-CES4A Antibody (CBMOAB-39080FYA)


Cat: CBMOAB-39080FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39080FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO39080FYA 100 µg
MO-AB-10094R Monoclonal Cattle (Bos taurus) WB, ELISA MO10094R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO39080FYA
SpecificityThis antibody binds to Rhesus CES4A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They also participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This gene, also called CES6, encodes a secreted enzyme, and may play a role in the detoxification of drugs and xenobiotics in neural and other tissues of the body and in the cerebrospinal fluid. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature and/or biological validity of some variants have not been determined. (From NCBI)
Product OverviewMouse Anti-Rhesus CES4A Antibody is a mouse antibody against CES4A. It can be used for CES4A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCES4A
UniProt IDF7FMF6
Protein RefseqThe length of the protein is 440 amino acids long.
The sequence is show below: NIYSPAEATTGASRPVMVWVHGGSLITGAATSYDESALAAYGDVVVVIVQYHLGVLGFFSTGDEHAPGNQGFLDVVAALRWVQGNITPFGGDLNCVTVFGGSAGGSIVSGLVLSPVAAGLFHRAITQSGVITSQGIIESHPPLAQKVAHLAGYNQNSTQILVNCLRALSGAKVMCVSNKMRFLQLNFQRDPEEIIWSMSPVEDGVVIPDDSLVLLTQGQVSSVPYLLGVNNLEFNWLLPYIMKFPLNRQAMRKETITKMLWSTRSLLNITKEQVPLVVEEYLDNVNEHNWKMLRNCMMDIVQDATFVYAMLQTVHYHYVGLPVYLYEFEHHARGIIVKPRTDWADHGDEMYFLFGGPFATGLFTGKEKALSLQMMKYWANFACTGNPNDGNLPCWPRYNKDEKYLQLDFTTSVGMKLKEKKMAFCVSLYQSQRPEKQRQF.
For Research Use Only | Not For Clinical Use.
Online Inquiry