AibGenesis™ Mouse Anti-CFAP126 Antibody (MO-AB-03512W)


Cat: MO-AB-03512W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03512W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO03512W 100 µg
MO-AB-10100R Monoclonal Cattle (Bos taurus) WB, ELISA MO10100R 100 µg
MO-AB-24733H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24733C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO03512W
SpecificityThis antibody binds to Rhesus CFAP126.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CFAP126 Antibody is a mouse antibody against CFAP126. It can be used for CFAP126 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCilia And Flagella Associated Protein 126; C1orf192; Fltp; Cilia- And Flagella-Associated Protein 126; Chromosome 1 Open Reading Frame 192; UPF0740 Protein C1orf192; Protein Flattop; Flattop
UniProt IDG7MEA2
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: MATNYSANQYEKAFSSKYLQNWSPAKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANPWGCFMGTWQMPLKIPPARVTLTSRTTAGAASLTKWIQKNSDLLKASNGLRPEILGKPHDPDSQKKLRKKSITKTVQQALSPTIIPSSPAANLNSPDDLRSSHPSAGHTPGPQSPAKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry