Mouse Anti-CFI Antibody (CBMOAB-39094FYA)
Cat: CBMOAB-39094FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39094FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) | WB, ELISA | MO39094FYA | 100 µg | ||
| CBMOAB-70223FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70223FYA | 100 µg | ||
| MO-AB-02358H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02358C | 100 µg | ||
| MO-AB-10114R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10114R | 100 µg | ||
| MO-AB-10884Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10884Y | 100 µg | ||
| MO-AB-19233W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19233W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) |
| Clone | MO39094FYA |
| Specificity | This antibody binds to Rhesus CFI. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uremic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immune deposits and age-related macular degeneration are other conditions associated with mutations of this gene. |
| Product Overview | Mouse Anti-Rhesus CFI Antibody is a mouse antibody against CFI. It can be used for CFI detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Complement factor I preproprotein; CFI |
| UniProt ID | H9F2U2 |
| Protein Refseq | The length of the protein is 476 amino acids long. The sequence is show below: AGGKFSVSLKHGNTDSEGIVEVKLVDQDKAMFVCKSSWSMREANVACLDLGFQQGADSERRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMDYQDLADVVCYTQKADSPTNDSFQCVNGKYISQTKACDGINDCGDQSDELCCKACHGRSFHCKSDVCIPSQYRCNGEVDCITGDDEVGCEGFASVAQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHVRRKRIVGGKLAKLGDFPWQVGIKDAKGITCGGIYIGGCWVLTAAHCLSASKTHRYQIWTTVVDWIHPSIKDIVVEYADRIIFHENYNAGTYQNDIALIKMKKEGNKKDCELPRSIPACVPWSPYLFQPDDTCIISGWGREKDNEKVFSLRWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPLISQHNV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry