AibGenesis™ Mouse Anti-CFI Antibody (CBMOAB-39094FYA)


Cat: CBMOAB-39094FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39094FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) WB, ELISA MO39094FYA 100 µg
CBMOAB-70223FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70223FYA 100 µg
MO-AB-02358H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02358C 100 µg
MO-AB-10114R Monoclonal Cattle (Bos taurus) WB, ELISA MO10114R 100 µg
MO-AB-10884Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10884Y 100 µg
MO-AB-19233W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19233W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio)
CloneMO39094FYA
SpecificityThis antibody binds to Rhesus CFI.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uremic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immune deposits and age-related macular degeneration are other conditions associated with mutations of this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus CFI Antibody is a mouse antibody against CFI. It can be used for CFI detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement factor I preproprotein; CFI
UniProt IDH9F2U2
Protein RefseqThe length of the protein is 476 amino acids long.
The sequence is show below: AGGKFSVSLKHGNTDSEGIVEVKLVDQDKAMFVCKSSWSMREANVACLDLGFQQGADSERRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMDYQDLADVVCYTQKADSPTNDSFQCVNGKYISQTKACDGINDCGDQSDELCCKACHGRSFHCKSDVCIPSQYRCNGEVDCITGDDEVGCEGFASVAQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHVRRKRIVGGKLAKLGDFPWQVGIKDAKGITCGGIYIGGCWVLTAAHCLSASKTHRYQIWTTVVDWIHPSIKDIVVEYADRIIFHENYNAGTYQNDIALIKMKKEGNKKDCELPRSIPACVPWSPYLFQPDDTCIISGWGREKDNEKVFSLRWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPLISQHNV.
For Research Use Only | Not For Clinical Use.
Online Inquiry