Mouse Anti-CHCHD4 Antibody (CBMOAB-39134FYA)


Cat: CBMOAB-39134FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39134FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39134FYA 100 µg
CBMOAB-70301FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70301FYA 100 µg
MO-AB-10141R Monoclonal Cattle (Bos taurus) WB, ELISA MO10141R 100 µg
MO-AB-22009W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22009W 100 µg
MO-AB-24758H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24758C 100 µg
MO-AB-52905W Monoclonal Marmoset WB, ELISA MO52905W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39134FYA
SpecificityThis antibody binds to Rhesus CHCHD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).
Product OverviewMouse Anti-Rhesus CHCHD4 Antibody is a mouse antibody against CHCHD4. It can be used for CHCHD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCHCHD4
UniProt IDF7DGV0
Protein RefseqThe length of the protein is 155 amino acids long.
The sequence is show below: MPVSYSSVTTRYYHRAGAKEGKDRIIFVTKEDHETPSNAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQVEETAPTEATATKEEEGSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry