Mouse Anti-CHD1 Antibody (MO-AB-23034H)


Cat: MO-AB-23034H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23034H Monoclonal Mallard (Anas platyrhynchos), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes) WB, ELISA MO23034C 100 µg
CBMOAB-01414HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO01414HB 100 µg
MO-AB-20811W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20811W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes)
CloneMO23034C
SpecificityThis antibody binds to Mallard CHD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.
Product OverviewThis product is a mouse antibody against CHD1. It can be used for CHD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromodomain helicase DNA binding protein 1; CHD1
UniProt IDT2HRG3
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: LLVVPLSTLTSWQREIQTWAPQMNAVVYSGDITSRNMIRTHEWMHPQTKRLKFNILLTTYEILLKDKSFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSSWEDFEEEHGKGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDDNEFYNKQEALQHLIRSSGKLILLD.
For Research Use Only | Not For Clinical Use.
Online Inquiry