Mouse Anti-Chicken MTR Antibody (MO-AB-02986Y)


Cat: MO-AB-02986Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus)
CloneMO02986Y
SpecificityThis antibody binds to Chicken MTR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against MTR. It can be used for MTR detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesMesotocin receptor; MTR
UniProt IDG9M9K8
Protein RefseqThe length of the protein is 58 amino acids long. The sequence is show below: MLLASLNSCCNPWIYMLYTGHLFHDLMRRFLCCSARYLKARPACELSVGRKSHSSSFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry