Mouse Anti-Chicken MTR Antibody (MO-AB-02986Y)
Cat: MO-AB-02986Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chicken (Gallus gallus) |
Clone | MO02986Y |
Specificity | This antibody binds to Chicken MTR. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Product Overview | This product is a mouse antibody against MTR. It can be used for MTR detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Mesotocin receptor; MTR |
UniProt ID | G9M9K8 |
Protein Refseq | The length of the protein is 58 amino acids long. The sequence is show below: MLLASLNSCCNPWIYMLYTGHLFHDLMRRFLCCSARYLKARPACELSVGRKSHSSSFV. |
See other products for " MTR "
MO-AB-27395R | Mouse Anti-Pig MTR Antibody (MO-AB-27395R) |
CBMOAB-87767FYA | Mouse Anti-Zebrafish mtr Antibody (CBMOAB-87767FYA) |
MO-AB-23456H | Mouse Anti-Mallard MTR Antibody (MO-AB-23456H) |
MO-AB-24310W | Mouse Anti-Chimpanzee MTR Antibody (MO-AB-24310W) |
CBMOAB-51909FYA | Mouse Anti-Rhesus MTR Antibody (CBMOAB-51909FYA) |
CBMOAB-1763YC | Mouse Anti-E. coli mtr Antibody (CBMOAB-1763YC) |
MO-AB-16193R | Mouse Anti-Cattle MTR Antibody (MO-AB-16193R) |
MO-AB-59524W | Mouse Anti-Marmoset MTR Antibody (MO-AB-59524W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry