Mouse Anti-Chimpanzee AK2 Antibody (MO-AB-13096W)


Cat: MO-AB-13096W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO13096W
SpecificityThis antibody binds to Chimpanzee AK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.
Product OverviewMouse Anti-Chimpanzee AK2 Antibody is a mouse antibody against AK2. It can be used for AK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase 2, mitochondrial; AK 2; EC 2.7.4.3; ATP-AMP transphosphorylase 2; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; AK2
UniProt IDK7CM10
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI.
See other products for " AK2 "
MO-AB-14148YMouse Anti-Sheep AK2 Antibody (MO-AB-14148Y)
MO-AB-07174RMouse Anti-Cattle AK2 Antibody (MO-AB-07174R)
MO-AB-08025WMouse Anti-Cat AK2 Antibody (MO-AB-08025W)
MO-AB-43616WMouse Anti-Horse AK2 Antibody (MO-AB-43616W)
CBMOAB-65343FYAMouse Anti-Zebrafish ak2 Antibody (CBMOAB-65343FYA)
MO-AB-24013HMouse Anti-Rat Ak2 Antibody (MO-AB-24013H)
MO-AB-38436WMouse Anti-Gorilla AK2 Antibody (MO-AB-38436W)
MO-AB-28903WMouse Anti-Dog AK2 Antibody (MO-AB-28903W)
MO-DKB-00276WRabbit Anti-AK2 Antibody (MO-DKB-00276W)
MO-AB-50637WMouse Anti-Marmoset AK2 Antibody (MO-AB-50637W)
For Research Use Only | Not For Clinical Use.
Online Inquiry