Mouse Anti-Chimpanzee AK3 Antibody (MO-AB-26917W)
Cat: MO-AB-26917W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO26917W |
Specificity | This antibody binds to Chimpanzee AK3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Chimpanzee AK3 Antibody is a mouse antibody against AK3. It can be used for AK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate kinase 3; AK3 |
UniProt ID | Q6UIS0 |
Protein Refseq | The length of the protein is 54 amino acids long. The sequence is show below: RLRQYKDVAKPVIELYKSRGVLXQFSGTETNKIWPYVYTLFSNKITPIQSKEAY. |
See other products for " AK3 "
MO-AB-50640W | Mouse Anti-Marmoset AK3 Antibody (MO-AB-50640W) |
MO-AB-42930W | Mouse Anti-Hamsters AK3 Antibody (MO-AB-42930W) |
MO-AB-07133Y | Mouse Anti-Rabbit AK3 Antibody (MO-AB-07133Y) |
MO-AB-01320H | Mouse Anti-Frog ak3 Antibody (MO-AB-01320H) |
MO-AB-07175R | Mouse Anti-Cattle AK3 Antibody (MO-AB-07175R) |
MO-AB-00036R | Mouse Anti-Medaka AK3 Antibody (MO-AB-00036R) |
MO-AB-08416W | Mouse Anti-Cat AK3 Antibody (MO-AB-08416W) |
MO-AB-24015H | Mouse Anti-Rat Ak3 Antibody (MO-AB-24015H) |
MO-AB-23651R | Mouse Anti-Pig AK3 Antibody (MO-AB-23651R) |
MO-AB-34356W | Mouse Anti-Ferret AK3 Antibody (MO-AB-34356W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry